Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTA YRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGR CRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSAD GTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLH SLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD S
    • Molecular weight
      27 kDa
    • Amino acids
      24 to 273

Specifications

Our Abpromise guarantee covers the use of ab176080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

General Info

  • Alternative names
    • EGF like domain 7
    • EGF like domain containing protein 7
    • EGF like domain multiple 7
    • EGF-like protein 7
    • EGFL 7
    • EGFL7
    • EGFL7_HUMAN
    • Epidermal growth factor like domain protein 7
    • Epidermal growth factor-like protein 7
    • MEGF 7
    • MEGF7
    • MGC111117
    • Multiple EGF like domain protein 7
    • Multiple EGF-like domains protein 7
    • Multiple epidermal growth factor like domain protein 7
    • Multiple epidermal growth factor-like domains protein 7
    • NEU1
    • NEU1 protein
    • NOTCH4 like protein
    • NOTCH4-like protein
    • RP11 251M1.2
    • UNQ187/PRO1449
    • Vascular endothelial statin
    • VE statin
    • VE-statin
    • ZNEU 1
    • ZNEU1
    see all
  • Function
    Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cells adhesion to the substrate in vitro.
  • Sequence similarities
    Contains 2 EGF-like domains.
    Contains 1 EMI domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab176080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up