Recombinant Human Egr1 protein (ab114318)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP18146
    • SpeciesHuman
    • SequenceSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSP SVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
    • Molecular weight37 kDa including tags
    • Amino acids444 to 543

Specifications

Our Abpromise guarantee covers the use of ab114318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AT225
    • Early growth response 1
    • Early growth response protein 1
    • EGR 1
    • EGR-1
    • EGR1
    • EGR1_HUMAN
    • G0S30
    • KROX 24
    • KROX24
    • Nerve growth factor-induced clone A
    • Nerve growth factor-induced protein A
    • NGFI-A
    • NGFIA
    • TIS8
    • Transcription factor ETR103
    • Transcription factor Zif268
    • ZIF 268
    • ZIF268
    • Zinc finger protein 225
    • Zinc finger protein Krox-24
    • ZNF225
    see all
  • FunctionTranscriptional regulator. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation.
  • Sequence similaritiesBelongs to the EGR C2H2-type zinc-finger protein family.
    Contains 3 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Egr1 protein images

  • SDS-PAGE analysis of ab114318 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Egr1 protein (ab114318)

ab114318 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting Abcam.


No, the recombinant fragment ab114318 does not contain any of the three Zn binding domains.


I hope this information is helpful. Please do not hesitate to contact us if you have any additio...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"