Overview

  • Product name
    Recombinant Human EGR4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLT THVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQKARAEERLKGLGF YSLGLSFASL
    • Amino acids
      377 to 486
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AT133
    • Early growth response protein 4
    • Nerve growth factor induced clone C
    • NGFI C
    • NGFIC
    • PAT133
    see all
  • Relevance
    EGR4(Early Growth Response protein 4) is a zinc-finger transcription factor that activates the transcription of genes whose products are required for mitogenesis and differentiation. EGR4 is closely related to nerve growth factor-induced clone A (NGFI-A or EGR1), EGR2, and EGR3. These four early response (immediate early) proteins all contain very similar zinc-finger DNA binding domains and five highly homologous subdomains. EGR4 functionally cooperate with NFAT proteins and induce expression of IL2 and TNFalpha. Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
  • Cellular localization
    Nuclear

Images

  • ab158339 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up