Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAF EGTHMGPFVERGP
    • Amino acids
      365 to 427
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EH domain containing 2
    • EH domain containing 3
    • EH domain containing protein 2
    • EH domain-containing protein 2
    • EHD 2
    • Ehd2
    • EHD2_HUMAN
    • EHD3
    • FLJ96617
    • PAST 2
    • PAST homolog 2
    • PAST2
    see all
  • Function
    Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.
  • Tissue specificity
    Highly expressed in heart and moderately expressed in placenta, lung, and skeletal muscle.
  • Sequence similarities
    Contains 1 EF-hand domain.
    Contains 1 EH domain.
  • Domain
    The EH domain interacts with Asn-Pro-Phe (NPF) motifs of target proteins.
  • Cellular localization
    Cell membrane. Endosome membrane. Colocalizes with GLUT4 in intracellular tubulovesicular structures that are associated with cortical F-actin.
  • Information by UniProt

Images

  • ab162329 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up