Recombinant Human EHHADH protein (ab152359)

Overview

  • Product name
    Recombinant Human EHHADH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAEYTRLHNALALIRLRNPPVNAISTTLLRDIKEGLQKAVIDHTIKAIVI CGAEGKFSAGADIRGFSAPRTFGLTLGHVVDEIQRNEKPVVAAIQGMAFG GGLELALGCHYRIAHAEAQVGLPEVTLGLLPGARGTQLLPRLTGVPAALD LITSGRRILADEALKLGILDKVVNSDPVEEAIRFAQRVSDQPLESRRLCN KPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEVGIK KEEELFLYLLQSGQARALQYAFFAERKANKWSTPSGASWKTASARPVSSV GVVGLGTMGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASK MQQSGHPWSGPKPRLTSSVKELGGVDLVIEAVFEEMSLKKQVFAELSAVC KPEAFLCTNTSALDVDEIASSTDRPHLVIGTHFFSPAHVMKLLEVIPSQY SSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNPYYNQAYFLLEEGS KPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLLPGTPA RKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFL SRYRKTHHIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVY LHGYGWPRHKGGPMFYASTVGLPTVLEKLQKYYRQNPDIPQLEPSDYLKK LASQGNPPLKEWQSLAGSPSSKL
    • Molecular weight
      106 kDa including tags
    • Amino acids
      1 to 723

Specifications

Our Abpromise guarantee covers the use of ab152359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl. EC=4.2.1.17; EC=5.3.3.82.3; EC=1.1.1.35.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 hydroxyacyl CoA dehydrogenase
    • 3,2 trans enoyl CoA isomerase
    • 3-hydroxyacyl-CoA dehydrogenase
    • ECHD
    • ECHP_HUMAN
    • EHHADH
    • Enoyl Coenzyme A, hydratase/3 hydroxyacyl Coenzyme A dehydrogenase
    • L 3 hydroxyacyl CoA dehydrogenase
    • L bifunctional protein, peroxisomal
    • L PBE
    • LBFP
    • LBP
    • MGC120586
    • MS730
    • PBE
    • PBFE
    • Peroxisomal bifunctional enzyme
    • Peroxisomal enoyl CoA hydratase
    see all
  • Tissue specificity
    Liver and kidney. Lower amounts seen in the brain.
  • Pathway
    Lipid metabolism; fatty acid beta-oxidation.
  • Sequence similarities
    In the N-terminal section; belongs to the enoyl-CoA hydratase/isomerase family.
    In the C-terminal section; belongs to the 3-hydroxyacyl-CoA dehydrogenase family.
  • Post-translational
    modifications
    Acetylated, leading to enhanced enzyme activity. Acetylation is enhanced by up to 80% after treatment either with trichostin A (TSA) or with nicotinamide (NAM) with highest increase on Lys-346. Acetylation and enzyme activity increased by about 1.5% on addition of fatty acids.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152359 stained with Coomassie Blue.

References

ab152359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up