Overview

  • Product name
    Recombinant Human EI2BL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPA IALVGCLSLAVELQAGAGGPGLAALVAFVRDKLSFLVTARPTAVNMARAA RDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDNRSIGDLGARH LLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCT ETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRV VANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEER PGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELR TALTTTISSRDGTLDGPQM
    • Amino acids
      1 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EI2BL
    • M1Pi
    • Mediator of RhoA-dependent invasion
    • Methylthioribose 1 phosphate isomerase 1
    • Methylthioribose 1 phosphate isomerase homolog
    • Methylthioribose-1-phosphate isomerase
    • MGC3207
    • MRDI
    • mri1
    • MTNA
    • MTNA_HUMAN
    • MTR-1-P isomerase
    • S methyl 5 thioribose 1 phosphate isomerase 1
    • S-methyl-5-thioribose-1-phosphate isomerase
    • Translation initiation factor eIF 2B
    • Translation initiation factor eIF-2B subunit alpha/beta/delta-like protein
    • Ypr118w
    see all
  • Function
    Catalyzes the interconversion of methylthioribose-1-phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1-P). Independently from catalytic activity, promotes cell invasion in response to constitutive RhoA activation by promoting FAK tyrosine phosphorylation and stress fiber turnover.
  • Pathway
    Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 1/6.
  • Sequence similarities
    Belongs to the eIF-2B alpha/beta/delta subunits family. MtnA subfamily.
  • Cellular localization
    Nucleus. Cytoplasm. Cell projection. Primarily nuclear, but cytoplasmic in cancer cells, with enrichment at leading edge of the plasma membrane in late stage tumor cells.
  • Information by UniProt

Images

  • ab164532 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up