Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEEL FSLMVVNRLTEELGCDEIIDRE
    • Amino acids
      116 to 187
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 21 kDa pRb associated protein
    • 21 kDa pRb-associated protein
    • C15orf3
    • CBP
    • Chromosome 15 open reading frame 3
    • CREBBP/EP300 inhibitor 1
    • CREBBP/EP300 inhibitory protein 1
    • CRI 1
    • CRI1
    • E1A like inhibitor of differentiation
    • E1A-like inhibitor of differentiation 1
    • EID 1
    • EID-1
    • EID1
    • EID1_HUMAN
    • EP300 interacting inhibitor of differentiation 1
    • EP300-interacting inhibitor of differentiation 1
    • IRO45620
    • MGC138883
    • MGC138884
    • NB4 apoptosis related protein
    • PNAS 22
    • PNAS22
    • PTD014
    • Rb and p300 binding protein EID 1
    • Rb and p300 binding protein EID1
    • RBP21
    • Retinoblastoma protein associated protein
    see all
  • Function
    Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms.
  • Tissue specificity
    Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A549 and various leukemia cell lines.
  • Developmental stage
    Expression decreased with development in ventricular tissue while remaining highly expressed in adult atrial tissue. In primary cultures of human skeletal myocytes, expression decreased during myogenic differentiation (at protein level).
  • Post-translational
    modifications
    Ubiquitinated in U-2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit.
  • Cellular localization
    Nucleus. Cytoplasm. May shuttle between nucleus and cytoplasm.
  • Information by UniProt

Images

  • ab161757 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up