Recombinant Human EIF1AY protein (ab103788)

Overview

  • Product name
    Recombinant Human EIF1AY protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELV FKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDD EIQFDDIGDDDEDIDDI
    • Molecular weight
      19 kDa including tags
    • Amino acids
      1 to 144
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103788 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • eIF 1A Y isoform
    • eIF 4C
    • eIF-1A Y isoform
    • EIF-4C
    • EIF1AY
    • Eukaryotic translation initiation factor 1A
    • Eukaryotic translation initiation factor 1A, Y chromosomal
    • Eukaryotic translation initiation factor 1A, Y linked
    • Eukaryotic translation initiation factor 4C
    • IF1AY_HUMAN
    • Y-chromosomal
    see all
  • Function
    Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the eIF-1A family.
    Contains 1 S1-like domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103788.

References

ab103788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up