Recombinant Human EIF1AY protein (ab103788)

Overview

  • Product nameRecombinant Human EIF1AY protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO14602
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMPKNKGKGGKNRRRGKNENESEKRELV FKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDD EIQFDDIGDDDEDIDDI
    • Molecular weight19 kDa including tags
    • Amino acids1 to 144
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab103788 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • eIF 1A Y isoform
    • eIF 4C
    • eIF-1A Y isoform
    • EIF-4C
    • EIF1AY
    • Eukaryotic translation initiation factor 1A
    • Eukaryotic translation initiation factor 1A, Y chromosomal
    • Eukaryotic translation initiation factor 1A, Y linked
    • Eukaryotic translation initiation factor 4C
    • IF1AY_HUMAN
    • Y-chromosomal
    see all
  • FunctionSeems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the eIF-1A family.
    Contains 1 S1-like domain.
  • Information by UniProt

Recombinant Human EIF1AY protein images

  • 15% SDS-PAGE analysis of 3µg ab103788.

References for Recombinant Human EIF1AY protein (ab103788)

ab103788 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"