Overview

  • Product name
    Recombinant Human EIF1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDY IHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYG EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 113
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104647 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • eIF1b
    • EIF1B_HUMAN
    • Eukaryotic translation initiation factor 1b
    • Protein translation factor SUI1 homolog GC20
  • Function
    Probably involved in translation.
  • Sequence similarities
    Belongs to the SUI1 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104647 at approximately 15kDa (3µg).

References

ab104647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up