Overview

  • Product name
    Recombinant Human EIF1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDY IHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYG EVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
    • Molecular weight
      15 kDa including tags
    • Amino acids
      1 to 113
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab104647 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • eIF1b
    • EIF1B_HUMAN
    • Eukaryotic translation initiation factor 1b
    • Protein translation factor SUI1 homolog GC20
  • Function
    Probably involved in translation.
  • Sequence similarities
    Belongs to the SUI1 family.
  • Information by UniProt

Recombinant Human EIF1B protein images

  • 15% SDS-PAGE showing ab104647 at approximately 15kDa (3µg).

References for Recombinant Human EIF1B protein (ab104647)

ab104647 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up