Recombinant Human EIF2AK1 protein (ab153284)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRS AKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
    • Amino acids
      81 to 180
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E2AK1_HUMAN
    • EC 2.7.11.1
    • Eif2ak1
    • Eukaryotic translation initiation factor 2 alpha kinase 1
    • Eukaryotic translation initiation factor 2-alpha kinase 1
    • HCR
    • Heme controlled repressor
    • Heme regulated eukaryotic initiation factor eIF 2 alpha kinase
    • Heme regulated inhibitor
    • Heme regulated initiation factor 2 alpha kinase
    • Heme regulated repressor
    • Heme sensitive initiation factor 2a kinase
    • Heme-controlled repressor
    • Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase
    • Heme-regulated inhibitor
    • Hemin sensitive initiation factor 2 alpha kinase
    • Hemin-sensitive initiation factor 2-alpha kinase
    • HRI
    • KIAA1369
    • PRO1362
    see all
  • Function
    Inhibits protein synthesis at the translation initiation level, in response to various stress conditions, including oxidative stress, heme deficiency, osmotic shock and heat shock. Exerts its function through the phosphorylation of EIF2S1 at 'Ser-48' and 'Ser-51', thus preventing its recycling. Binds hemin forming a 1:1 complex through a cysteine thiolate and histidine nitrogenous coordination. This binding occurs with moderate affinity, allowing it to sense the heme concentration within the cell. Thanks to this unique heme-sensing capacity, plays a crucial role to shut off protein synthesis during acute heme-deficient conditions. In red blood cells (RBCs), controls hemoglobin synthesis ensuring a coordinated regulation of the synthesis of its heme and globin moieties. Thus plays an essential protective role for RBC survival in anemias of iron deficiency. Similarly, in hepatocytes, involved in heme-mediated translational control of CYP2B and CYP3A and possibly other hepatic P450 cytochromes. May also contain ER stress during acute heme-deficient conditions.
  • Tissue specificity
    Expressed predominantly in erythroid cells. At much lower levels, expressed in hepatocytes (at protein level).
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. GCN2 subfamily.
    Contains 2 HRM (heme regulatory motif) repeats.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Activated by autophosphorylation; phosphorylated predominantly on serine and threonine residues, but also on tyrosine residues. Autophosphorylation at Thr-488 is required for kinase activation. The active autophosphorylated form apparently is largely refractory to cellular heme fluctuations.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153284 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up