Recombinant Human eIF2B epsilon protein (ab152937)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFY QLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
    • Amino acids
      622 to 720
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CACH
    • CLE
    • EI2BE_HUMAN
    • EIF 2B
    • eIF 2B GDP GTP exchange factor
    • eIF 2B GDP GTP exchange factor subunit epsilon
    • eIF-2B GDP-GTP exchange factor subunit epsilon
    • EIF2B
    • EIF2B5
    • EIF2BE
    • EIF2Bepsilon
    • Eukaryotic Translation Initiation Factor 2 Beta Epsilon
    • Eukaryotic translation initiation factor 2B subunit 5 epsilon
    • Eukaryotic translation initiation factor 2B subunit 5 epsilon 82kDa
    • LVWM
    • Translation initiation factor eIF 2B subunit epsilon
    • Translation initiation factor eIF-2B subunit epsilon
    see all
  • Function
    Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
  • Involvement in disease
    Defects in EIF2B5 are a cause of leukodystrophy with vanishing white matter (VWM) [MIM:603896]. VWM is a leukodystrophy that occurs mainly in children. Neurological signs include progressive cerebellar ataxia, spasticity, inconstant optic atrophy and relatively preserved mental abilities. The disease is chronic-progressive with, in most individuals, additional episodes of rapid deterioration following febrile infections or minor head trauma. While childhood onset is the most common form of the disorder, some severe forms are apparent at birth. A severe, early-onset form seen among the Cree and Chippewayan populations of Quebec and Manitoba is called Cree leukoencephalopathy. Milder forms may not become evident until adolescence or adulthood. Some females with milder forms of the disease who survive to adolescence exhibit ovarian dysfunction. This variant of the disorder is called ovarioleukodystrophy.
  • Sequence similarities
    Belongs to the eIF-2B gamma/epsilon subunits family.
    Contains 1 W2 domain.
  • Information by UniProt

Images

  • ab152937 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152937 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152937.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up