Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41214
    • SpeciesHuman
    • SequenceKGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTV NPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK
    • Molecular weight37 kDa including tags
    • Amino acids485 to 584

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Eukaryotic translation initiation factor 2D
    • HCA56
    • Hepatocellular carcinoma associated antigen 56
    • Hepatocellular carcinoma-associated antigen 56
    • LGTN
    • LIGA_HUMAN
    • Ligatin
    • OTTHUMP00000034537
    • OTTHUMP00000034538
    see all
  • FunctionTrafficking receptor for phosphoglycoproteins. Localizes phosphoglycoproteins within endosomes and at the cell periphery where they participate in specific metabolic processes as well as intercellular adhesion.
  • Sequence similaritiesBelongs to the ligatin family.
    Contains 1 PUA domain.
    Contains 1 SUI1 domain.
  • Developmental stageFound during embryonic development and in early differentiated states.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human EIF2D protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116939 at approximately 36.63 kDa.

References for Recombinant Human EIF2D protein (ab116939)

ab116939 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"