Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTV NPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      485 to 584

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116939 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Eukaryotic translation initiation factor 2D
    • HCA56
    • Hepatocellular carcinoma associated antigen 56
    • Hepatocellular carcinoma-associated antigen 56
    • LGTN
    • LIGA_HUMAN
    • Ligatin
    • OTTHUMP00000034537
    • OTTHUMP00000034538
    see all
  • Function
    Trafficking receptor for phosphoglycoproteins. Localizes phosphoglycoproteins within endosomes and at the cell periphery where they participate in specific metabolic processes as well as intercellular adhesion.
  • Sequence similarities
    Belongs to the ligatin family.
    Contains 1 PUA domain.
    Contains 1 SUI1 domain.
  • Developmental stage
    Found during embryonic development and in early differentiated states.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116939 at approximately 36.63 kDa.

References

ab116939 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116939.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up