Overview

  • Product name
    Recombinant Human EIF2G protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNP VCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
    • Molecular weight
      36 kDa including tags
    • Amino acids
      383 to 472

Specifications

Our Abpromise guarantee covers the use of ab114818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • eIF-2-gamma X
    • eIF-2gA
    • eIF-2gX
    • EIF2
    • EIF2G
    • EIF2gamma
    • EIF2S3
    • Eukaryotic translation initiation factor 2 gamma
    • Eukaryotic translation initiation factor 2 gamma subunit
    • Eukaryotic translation initiation factor 2 subunit 3
    • Eukaryotic translation initiation factor 2 subunit 3 gamma 52kDa
    • Eukaryotic translation initiation factor 2 subunit gamma X
    • IF2G_HUMAN
    see all
  • Function
    eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
  • Sequence similarities
    Belongs to the GTP-binding elongation factor family. EIF2G subfamily.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up