Overview

  • Product nameRecombinant Human EIF2G protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41091
    • SpeciesHuman
    • SequenceGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNP VCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
    • Molecular weight36 kDa including tags
    • Amino acids383 to 472

Specifications

Our Abpromise guarantee covers the use of ab114818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • eIF-2-gamma X
    • eIF-2gA
    • eIF-2gX
    • EIF2
    • EIF2G
    • EIF2gamma
    • EIF2S3
    • Eukaryotic translation initiation factor 2 gamma
    • Eukaryotic translation initiation factor 2 gamma subunit
    • Eukaryotic translation initiation factor 2 subunit 3
    • Eukaryotic translation initiation factor 2 subunit 3 gamma 52kDa
    • Eukaryotic translation initiation factor 2 subunit gamma X
    • IF2G_HUMAN
    see all
  • FunctioneIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
  • Sequence similaritiesBelongs to the GTP-binding elongation factor family. EIF2G subfamily.
  • Information by UniProt

Recombinant Human EIF2G protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human EIF2G protein (ab114818)

ab114818 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"