Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP60228
    • SpeciesHuman
    • SequenceRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGN NAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
    • Molecular weight37 kDa including tags
    • Amino acids346 to 445

Specifications

Our Abpromise guarantee covers the use of ab114770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • eIF-3 p48
    • eIF3e
    • EIF3E_HUMAN
    • EIF3S6
    • eIFe
    • Eukaryotic translation initiation factor 3 subunit 6
    • Eukaryotic translation initiation factor 3 subunit E
    • eukaryotic translation initiation factor 3, subunit 6 (48kD)
    • INT6
    • mammary tumor-associated protein INT6
    • murine mammary tumor integration site 6 (oncogene homolog)
    • Viral integration site protein INT-6 homolog
    see all
  • FunctionComponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
  • Tissue specificityUbiquitously expressed. Expressed at highest levels in appendix, lymph, pancreas, skeletal muscle, spleen and thymus.
  • Sequence similaritiesBelongs to the eIF-3 subunit E family.
    Contains 1 PCI domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Nucleus > PML body.
  • Information by UniProt

Recombinant Human eIF3e protein images

  • ab114770 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human eIF3e protein (ab114770)

ab114770 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"