Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPA AAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILA SIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDM EFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHL TVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVD LIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSA DNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL NEKLVNL
    • Amino acids
      1 to 357
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme eIF3f
    • eIF 3 epsilon
    • eIF-3-epsilon
    • eIF3 p47
    • eIF3 p47 subunit
    • eIF3-epsilon
    • eIF3-p47
    • eIF3f
    • EIF3F_HUMAN
    • EIF3S5
    • EIF3S5, formerly
    • Eukaryotic translation initiation factor 3 subunit 5
    • Eukaryotic translation initiation factor 3 subunit 5, formerly
    • Eukaryotic translation initiation factor 3 subunit F
    • eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD)
    • eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa
    • eukaryotic translation initiation factor 3, subunit F
    • translation initiation factor 3 47 kda subunit
    see all
  • Function
    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
    Deubiquitinates activated NOTCH1, promoting its nuclear import, thereby acting as a positive regulator of Notch signaling.
  • Sequence similarities
    Belongs to the eIF-3 subunit F family.
    Contains 1 MPN (JAB/Mov34) domain.
  • Domain
    The MPN domain mediates deubiquitinating activity.
  • Post-translational
    modifications
    Phosphorylation is enhanced upon serum stimulation. Phosphorylated during apoptosis by caspase-processed CDK11.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab152904 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up