Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UBQ5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAMFEQMRANVGKLLKGIDRYNPENLATLE RYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHT DFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEG ITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
    • Molecular weight27 kDa including tags
    • Amino acids1 to 218
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104639 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ARG134
    • eIF 3 p25
    • eIF 3 p28
    • eIF-3 p25
    • eIF-3 p28
    • EIF3-p28
    • eif3k
    • EIF3K_HUMAN
    • EIF3S12
    • Eukaryotic translation initiation factor 3 subunit 12
    • Eukaryotic translation initiation factor 3 subunit K
    • HSPC029
    • M9
    • MSTP001
    • Muscle specific gene M9 protein
    • Muscle-specific gene M9 protein
    • PLAC 24
    • PLAC-24
    • PLAC24
    • PRO1474
    • PTD001
    see all
  • FunctionComponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
  • Tissue specificityUbiquitous, with the highest levels of expression in brain, testis and kidney.
  • Sequence similaritiesBelongs to the eIF-3 subunit K family.
  • Cellular localizationNucleus. Cytoplasm.
  • Information by UniProt

Recombinant Human eIF3K protein images

  • 15% SDS-PAGE analysis of 3µg ab104639.

References for Recombinant Human eIF3K protein (ab104639)

ab104639 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"