Recombinant Human eIF4A2 protein (ab158340)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA YGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase eIF4A 2
    • ATP-dependent RNA helicase eIF4A-2
    • BM-010
    • DDX2B
    • eIF 4A II
    • eIF-4A-II
    • EIF4A
    • eIF4A II
    • eIF4A-II
    • EIF4A2
    • EIF4F
    • Eukaryotic initiation factor 4A II
    • Eukaryotic initiation factor 4A-II
    • eukaryotic translation initiation factor 4A isoform 2
    • Eukaryotic translation initiation factor 4A2
    • IF4A2_HUMAN
    • N-terminally processed
    see all
  • Function
    ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
  • Sequence similarities
    Belongs to the DEAD box helicase family. eIF4A subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Information by UniProt

Images

  • ab158340 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158340 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up