Overview

  • Product nameRecombinant Human eIF4B protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23588
    • SpeciesHuman
    • SequenceMAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGD VSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFL GNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSL LSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWR ARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPCRDMD RYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRP RERHPSWRSEETQERERSRTGSESSQTGTSTTSSRNARRRESEKSLENET LNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPARSQSSDT EQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDG GNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG EDENEGEDYAE
    • Molecular weight93 kDa including tags
    • Amino acids1 to 611

Specifications

Our Abpromise guarantee covers the use of ab114511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310046H11Rik
    • AL024095
    • C85189
    • EIF 4B
    • eIF-4B
    • EIF4B
    • Eukaryotic initiation factor 4B
    • Eukaryotic translation initiation factor 4B
    • IF4B_HUMAN
    • PRO1843
    see all
  • FunctionRequired for the binding of mRNA to ribosomes. Functions in close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.
  • Sequence similaritiesContains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated at Ser-422 by RPS6KA1 and RPS6KB1; phosphorylation enhances the affinity of EIF4B for the EIF3 complex.
  • Information by UniProt

Recombinant Human eIF4B protein images

  • ab114511 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human eIF4B protein (ab114511)

ab114511 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"