Recombinant Human eIF4ENIF1 protein (ab163380)

Overview

  • Product name
    Recombinant Human eIF4ENIF1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLP HMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
    • Amino acids
      886 to 985
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2610509L04Rik
    • 4E T
    • 4E-T
    • 4ET
    • 4ET_HUMAN
    • A930019J01Rik
    • AA410001
    • AU021239
    • Clast 4
    • Clast4
    • D11Ertd166e
    • eIF4E transporter
    • Eif4enif1
    • Eukaryotic translation initiation factor 4E nuclear import factor 1
    • Eukaryotic translation initiation factor 4E transporter
    • FLJ21601
    • FLJ26551
    • OTTMUSP00000000698
    • OTTMUSP00000005193
    • OTTMUSP00000005194
    • OTTMUSP00000036075
    see all
  • Function
    Nucleoplasmic shuttling protein. Mediates the nuclear import of EIF4E by a piggy-back mechanism.
  • Tissue specificity
    Widely expressed.
  • Cellular localization
    Cytoplasm. Nucleus. Predominantly cytoplasmic. Shuttles between the nucleus and the cytoplasm in a CRM1-dependent manner.
  • Information by UniProt

Images

  • ab163380 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up