Overview

  • Product nameRecombinant Human EIF5 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP55010
    • SpeciesHuman
    • SequenceMSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPP TYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCP ECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD SGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEED DDWGEDTTEEAQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKK KEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHF LRFCHNNKKAKRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDEN IEVVYSKAASVPKVETVKSDNKDDDIDIDAI
    • Molecular weight74 kDa including tags
    • Amino acids1 to 431

Specifications

Our Abpromise guarantee covers the use of ab116832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2810011H21Rik
    • D12Ertd549e
    • EIF 5
    • EIF 5A
    • eIF-5
    • Eif5
    • Eukaryotic initiation factor 5
    • Eukaryotic translation initiation factor 5
    • IF5_HUMAN
    • MGC36374
    • MGC36509
    see all
  • FunctionCatalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).
  • Sequence similaritiesBelongs to the eIF-2-beta/eIF-5 family.
    Contains 1 W2 domain.
  • Information by UniProt

Recombinant Human EIF5 protein images

  • ab116832 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human EIF5 protein (ab116832)

ab116832 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116832.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"