Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9GZV4
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGF VVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMD VPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAG EDVQVSVMCAMSEEYAVAIKPCK
    • Molecular weight19 kDa including tags
    • Amino acids1 to 153
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity>= 85 % SDS-PAGE.
    ab99140 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 9630038B20
    • eIF 5A 2
    • eIF 5A2
    • eIF-4D
    • eIF-5A-2
    • eIF-5A2
    • EIF5A 2
    • EIF5A2
    • eIF5AII
    • Eukaryotic initiation factor 5A isoform 2
    • Eukaryotic translation initiation factor 5A-2
    • Eukaryotic translation initiation factor 5A2
    • IF5A2_HUMAN
    see all
  • FunctionmRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. Functions as a regulator of apoptosis. Mediates effects of polyamines on neuronal process extension and survival. May play an important role in brain development and function, and in skeletal muscle stem cell differentiation.
  • Tissue specificityExpressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells.
  • Sequence similaritiesBelongs to the eIF-5A family.
  • Post-translational
    modifications
    eIF-5A seems to be the only eukaryotic protein to have an hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine).
  • Cellular localizationCytoplasm. Nucleus. Endoplasmic reticulum membrane. Nucleus > nuclear pore complex. Hypusine modification promotes the nuclear export and cytoplasmic localization and there was a dynamic shift in the localization from predominantly cytoplasmic to primarily nuclear under apoptotic inducing conditions.
  • Information by UniProt

Recombinant Human eIF5A2 protein images

  • 15% SDS-PAGE analysis of 3µg ab99140

References for Recombinant Human eIF5A2 protein (ab99140)

ab99140 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"