Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQL KAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSMVSKQPIEIYGPVGLR DFIWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKE EQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGFSVVEKKRPGKL NAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICI LGDCSGVVGDGGVKLCFEADLLIHEATLDDAQMDKAKEHGHSTPQMAATF AKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTL AEDFMVISIPIKK
    • Amino acids
      1 to 363
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D29
    • Deleted in Ma29
    • ELAC 1
    • ElaC homolog 1
    • ElaC homolog 1 (E. coli)
    • ElaC homolog protein 1
    • ELAC1
    • Ribonuclease Z 1
    • RNase Z 1
    • RNZ1_HUMAN
    • tRNA 3 endonuclease 1
    • tRNA 3' processing endoribonuclease
    • tRNA Z
    • tRNA Z (short form)
    • tRNase Z 1
    • tRNase ZS
    • Zinc phosphodiesterase ELAC protein 1
    see all
  • Function
    Zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
  • Tissue specificity
    Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the RNase Z family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163110 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up