Recombinant Human ELAVL2 protein (ab158347)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNM TQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTL
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ELAV like neuron specific RNA binding protein 2
    • ELAV like Neuronal Protein 1
    • ELAV like Protein 2
    • ELAV-like neuronal protein 1
    • ELAV-like protein 2
    • ELAV2_HUMAN
    • ELAVL2
    • HEL-N1
    • HELN1
    • HU Antigen B
    • Hu-antigen B
    • HuB
    • Nervous System Specific RNA Binding Protein MelN1
    • Nervous system-specific RNA-binding protein Hel-N1
    see all
  • Function
    Binds RNA. Seems to recognize a GAAA motif. Can bind to its own 3'-UTR, the FOS 3'-UTR and the ID 3'-UTR.
  • Tissue specificity
    Brain; neural-specific.
  • Sequence similarities
    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Information by UniProt

Images

  • ab158347 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up