Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYAA QVLVYDDETYMMQDVAEEQEVETENVETVEASVHSSNAHCTDKT
    • Amino acids
      2 to 95
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E74 like factor 2
    • E74 like factor 2 ets domain transcription factor
    • ELF 2
    • Ets domain transcription factor
    • Ets related factor
    • ETS related transcription factor Elf 2
    • ETS related transcription factor Elf2
    • EU 32
    • EU32
    • HGNC:3317
    • NERF
    • NERF 1A
    • NERF 1a b
    • NERF 1B
    • NERF 2
    • NERF1A
    • NERF1a b
    • NERF1B
    • NERF2
    • New ETS related factor
    see all
  • Relevance
    The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1 mediated transcription of the B cell specific blk gene.
  • Cellular localization
    Nuclear

Images

  • ab158351 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up