Recombinant Human Elf4/MEF protein (ab158352)

Overview

  • Product name
    Recombinant Human Elf4/MEF protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELL RDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
    • Amino acids
      521 to 612
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E74-like factor 4
    • ELF4
    • ELF4_HUMAN
    • ELFR
    • ETS-related transcription factor Elf-4
    • ETS-related transcription factor Elf4
    • MEF
    • Myeloid Elf-1-like factor
    • Myeloid Elf1-like factor
    see all
  • Function
    Transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. Transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. Acts synergistically with RUNX1 to transactivate the IL3 promoter (By similarity). Also transactivates the PRF1 promoter in natural killer (NK) cells. Plays a role in the development and function of NK and NK T-cells and in innate immunity. Controls the proliferation and homing of CD8+ T cells via the Kruppel-like factors KLF4 and KLF2 (By similarity). Controls cell senescence in a p53-dependent manner. Can also promote celular transformation through inhibition of the p16 pathway.
  • Tissue specificity
    Abundantly expressed in the placenta and in a variety of myeloid leukemia cell lines. Moderate levels of expression in heart, lung, spleen, thymus, peripheral blood lymphocytes, ovary and colon. Lower levels of expression in Jurkat T-cells and other T-cell lines and no expression in brain.
  • Involvement in disease
    A chromosomal aberration involving ELF4 is a cause of acute myeloid leukemia (AML). Translocation t(X;21)(q25-26;q22) with ERG.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus > PML body. Accumulation into PML nuclear bodies is mediated by PML.
  • Information by UniProt

Images

  • ab158352 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up