Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW GQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED
    • Molecular weight
      36 kDa including tags
    • Amino acids
      166 to 263

Specifications

Our Abpromise guarantee covers the use of ab116821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E74 like factor 5
    • E74 like factor 5 (ets domain transcription factor)
    • E74-like factor 5
    • ELF 5
    • ELF5
    • ELF5_HUMAN
    • Epithelium restricted ESE 1 related Ets factor
    • Epithelium restricted ESE1 related Ets factor
    • Epithelium specific Ets transcription factor 2
    • Epithelium-restricted ESE-1-related Ets factor
    • Epithelium-specific Ets transcription factor 2
    • ESE 2
    • ESE-2
    • ESE2
    • Ets domain TF
    • Ets domain transcription factor
    • ETS related transcription factor Elf 5
    • ETS related transcription factor Elf5
    • ETS-related transcription factor Elf-5
    see all
  • Function
    Transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation.
    Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequence GGA[AT]. Transcriptionally activates SPRR2A and the parotid gland-specific PSP promoters.
  • Tissue specificity
    Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially expressed in different tissues. In the kidney, only isoform 1 was expressed, while prostate expressed both isoforms, with levels of isoform 2 being higher. Expression is up-regulated during keratinocyte differentiation. Several epithelial carcinoma cell lines showed lack of expression.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Domain
    The PNT domain acts as a transcriptional activator.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116821 at approximately 36.41 kDa.

References

ab116821 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up