Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UKW6
    • SpeciesHuman
    • SequenceSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMW GQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED
    • Molecular weight36 kDa including tags
    • Amino acids166 to 263

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116821 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E74 like factor 5
    • E74 like factor 5 (ets domain transcription factor)
    • E74-like factor 5
    • ELF 5
    • ELF5
    • ELF5_HUMAN
    • Epithelium restricted ESE 1 related Ets factor
    • Epithelium restricted ESE1 related Ets factor
    • Epithelium specific Ets transcription factor 2
    • Epithelium-restricted ESE-1-related Ets factor
    • Epithelium-specific Ets transcription factor 2
    • ESE 2
    • ESE-2
    • ESE2
    • Ets domain TF
    • Ets domain transcription factor
    • ETS related transcription factor Elf 5
    • ETS related transcription factor Elf5
    • ETS-related transcription factor Elf-5
    see all
  • FunctionTranscriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation.
    Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequence GGA[AT]. Transcriptionally activates SPRR2A and the parotid gland-specific PSP promoters.
  • Tissue specificityExpressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially expressed in different tissues. In the kidney, only isoform 1 was expressed, while prostate expressed both isoforms, with levels of isoform 2 being higher. Expression is up-regulated during keratinocyte differentiation. Several epithelial carcinoma cell lines showed lack of expression.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • DomainThe PNT domain acts as a transcriptional activator.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ELF5 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116821 at approximately 36.41 kDa.

References for Recombinant Human ELF5 protein (ab116821)

ab116821 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116821.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"