Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP41970
    • SpeciesHuman
    • SequenceSRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINS LQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
    • Molecular weight37 kDa including tags
    • Amino acids101 to 200

Specifications

Our Abpromise guarantee covers the use of ab114951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ELK3
    • ELK3, ETS domain protein (SRF accessory protein 2)
    • ELK3_HUMAN
    • ERP
    • ETS domain protein
    • ETS domain-containing protein Elk-3
    • ETS related protein ERP
    • ETS related protein NET
    • ETS-related protein ERP
    • ETS-related protein NET
    • NET
    • SAP 2
    • SAP-2
    • SAP2
    • Serum response factor accessory protein 2
    • SRF accessory protein 2
    see all
  • FunctionMay be a negative regulator of transcription, but can activate transcription when coexpressed with Ras, Src or Mos. Forms a ternary complex with the serum response factor and the ETS and SRF motifs of the Fos serum response element.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ELK3 protein images

  • 12.5% SDS-PAGE showing ab114951 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human ELK3 protein (ab114951)

ab114951 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"