Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP28324
    • SpeciesHuman
    • SequenceKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIK TENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA
    • Molecular weight35 kDa
    • Amino acids118 to 206

Specifications

Our Abpromise guarantee covers the use of ab114409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Elk4
    • ELK4_HUMAN
    • ETS domain containing protein Elk4
    • ETS domain protein
    • ETS domain-containing protein Elk-4
    • SAP-1
    • SAP1
    • Serum response factor accessory protein 1
    • SRF accessory protein 1
    • TCF1
    see all
  • FunctionForms a ternary complex with the serum response factor (SRF). Requires DNA-bound SRF for ternary complex formation and makes extensive DNA contacts to the 5'side of SRF, but does not bind DNA autonomously.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human ELK4 protein images

  • 12.5% SDS-PAGE analysis of ab114409 stained with Coomassie Blue.

References for Recombinant Human ELK4 protein (ab114409)

ab114409 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"