Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIFAREVISRNGLQILGTIIEDGDDLGEVLALSLRAFSELMEHGVVSWET LSIPFVRKVVCYVNMNLMDASVPPLALGLLESVTLSSPALGQLVKSEVPL DRLLVHLQVMNQQLQTKAMALLTALLQGASPVERKHMLDYLWQRNLRQFI YKNIIHSAAPMGDEMAHHLYVLQALMLGLLEPRMRTPLDPYSQEQREQLQ VLRQAAFEVEGESSGAGLSADRRRSLCAREFRKLGFSNSNPAQDLERVPP GLLALDNMLYFSRNAPSAYSRFVLENSSREDKHECPFARGSIQLTVLLCE LLRVGEPCSETAQDFSPMFFGQDQSFHELFCVGIQLLNKTWKEMRATQED FDKVMQVVREQLARTLALKPTSLELFRTKVNALTYGEVLRLRQTERLHQE GTLAPPILELREKLKPELMGLIRQQRLLRLCEGTLFRKISSRRRQDKLWF CCLSPNHKLLQYGDMEEGASPPTLESLPEQLPVADMRALLTGKDCPHVRE KGSGKQNKDLYELAFSISYDRGEEEAYLNFIAPSKREFYLWTDGLSALLG SPMGSEQTRLDLEQLLTMETKLRLLELENVPIPERPPPVPPPPTNFNFCY DCSIAEP
    • Amino acids
      1 to 607
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CED 12
    • Ced 12 homolog 3
    • CED12
    • ELMO 3
    • ELMO3
    • ELMO3_HUMAN
    • Engulfment and cell motility 3
    • Engulfment and cell motility protein 3
    • FLJ13824
    see all
  • Function
    Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.
  • Sequence similarities
    Contains 1 ELMO domain.
    Contains 1 PH domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164104 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up