Recombinant Human Elongin A protein (ab159645)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQ KKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSP PSCTSPHQMY
    • Amino acids
      81 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ela1
    • Elo A
    • EloA
    • ELOA1_HUMAN
    • Elongin 110 kDa subunit
    • Elongin-A
    • ElonginA
    • RNA polymerase II transcription factor SIII subunit A1
    • SIII
    • SIII p110
    • TCEB 3
    • Tceb3
    • TCEB3A
    • Transcription elongation factor B (SIII) polypeptide 3
    • Transcription elongation factor B (SIII) polypeptide 3 (110kD)
    • Transcription elongation factor B alpha subunit
    • Transcription elongation factor B polypeptide 3
    see all
  • Function
    SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 TFIIS N-terminal domain.
  • Domain
    The elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV].
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159645 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up