Recombinant Human ELOVL2 protein (ab162883)

Overview

  • Product name
    Recombinant Human ELOVL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIW LGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQ DLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHH ASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLW WKKYLTQAQLVQFVLAITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFL NFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
    • Amino acids
      1 to 296
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 keto acyl CoA synthase ELOVL2
    • 3-keto acyl-CoA synthase Elovl2
    • Elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 2
    • Elongation of very long chain fatty acids protein 2
    • ELOV2_HUMAN
    • ELOVL fatty acid elongase 2
    • Elovl2
    • FLJ20334
    • OTTHUMP00000016029
    • SSC2
    see all
  • Function
    Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA). Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA.
  • Tissue specificity
    Liver and testis.
  • Sequence similarities
    Belongs to the ELO family.
  • Domain
    The di-lysine motif may confer endoplasmic reticulum localization.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab162883 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up