Recombinant Human Elp4 protein (denatured) (ab187472)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAAVATCGSVAASTGSAVATASKSNVT SFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGG LAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQ ELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSS SRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKL LQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGN SHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGL ESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKL FTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHLDF
    • Molecular weight
      49 kDa including tags
    • Amino acids
      1 to 424
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab187472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • C11orf19
    • dJ68P15A.1
    • Elongation protein 4 homolog
    • elongation protein 4 homolog (S. cerevisiae)
    • Elongator complex protein 4
    • ELP4
    • ELP4_HUMAN
    • FLJ20498
    • hELP4
    • PAX6 neighbor gene protein
    • PAX6NEB
    • PAXNEB
    see all
  • Function
    Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the ELP4 family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab187472 (3µg).

References

ab187472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up