Overview

  • Product name
    Recombinant Human Emi1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCT KCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRR
    • Amino acids
      358 to 446
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Early mitotic inhibitor 1
    • Emi 1
    • EMI1
    • F box only protein 5
    • F box protein 5
    • F box protein Fbx 5
    • F box protein Fbx5
    • F-box only protein 5
    • FBX5
    • FBX5_HUMAN
    • Fbxo31
    • fbxo5
    see all
  • Function
    Regulates progression through early mitosis by inhibiting the anaphase promoting complex/cyclosome (APC). Binds to the APC activators CDC20 and FZR1/CDH1 to prevent APC activation. Can also bind directly to the APC to inhibit substrate-binding.
  • Sequence similarities
    Contains 1 F-box domain.
    Contains 1 IBR-type zinc finger.
  • Developmental stage
    Accumulates in late G1 phase, levels rise during S phase and drop in early mitosis.
  • Domain
    The C-terminal region is required for inhibition of APC activity.
  • Post-translational
    modifications
    Phosphorylation by CDK2 and subsequently by PLK1 triggers degradation during early mitosis through ubiquitin-mediated proteolysis by the SCF ubiquitin ligase complex containing the F-box protein BTRC. This degradation is necessary for the activation of APC in late mitosis and subsequent mitotic progression.
  • Cellular localization
    Nucleus. Cytoplasm. Cytoplasm > cytoskeleton > spindle. In interphase, localizes in a punctate manner in the nucleus and cytoplasm with some perinuclear concentration. In mitotic cells, localizes throughout the cell, particularly at the spindle.
  • Information by UniProt

Images

  • ab161960 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up