Overview

  • Product name
    Recombinant Human EMID2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDP GQKSVDQASSR
    • Amino acids
      380 to 440
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-1 type XXVI collagen
    • COL26A1
    • Collagen alpha 1(XXVI) chain
    • Collagen alpha-1(XXVI) chain
    • Collagen type XXVI alpha 1
    • COQA1_HUMAN
    • EMI domain containing 2
    • EMI domain containing protein 2
    • EMI domain-containing protein 2
    • EMI6
    • EMID 2
    • Emilin and multimerin domain containing protein 2
    • Emilin and multimerin domain-containing protein 2
    • Emu2
    • Protein Emu2
    • SH2B
    see all
  • Sequence similarities
    Contains 2 collagen-like domains.
    Contains 1 EMI domain.
  • Post-translational
    modifications
    Hydroxylated on proline residues.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab165395 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165395 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up