Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQED DIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNNG TVLPKKPTGSLPSPSGVRKETAVPATKSNIKRTSSSERVSPGGRRESNGD SRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYM PKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFI ASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQ LPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSND HVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTL EGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNR ISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIP EQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLA INASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVA VGTLTGRWFVFDTGTKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCI YIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWV PSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHE KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLI STGGKDTSIMQWRVI
    • Molecular weight
      116 kDa including tags
    • Amino acids
      1 to 815

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • echinoderm microtubule associated protein like 1
    • Echinoderm microtubule-associated protein-like 1
    • ELP79
    • EMAL1_HUMAN
    • EMAP
    • EMAP-1
    • EMAPL
    • Eml1
    • FLJ45033
    • HuEMAP
    • HuEMAP-1
    see all
  • Function
    May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.
  • Tissue specificity
    Ubiquitous; expressed in most tissues with the exception of thymus and peripheral blood lymphocytes.
  • Sequence similarities
    Belongs to the WD repeat EMAP family.
    Contains 10 WD repeats.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human EML1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116907 at approximately 115.76 kDa.

References for Recombinant Human EML1 protein (ab116907)

ab116907 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up