Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO00423
    • SpeciesHuman
    • SequenceMEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQED DIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNNG TVLPKKPTGSLPSPSGVRKETAVPATKSNIKRTSSSERVSPGGRRESNGD SRGNRNRTGSTSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYM PKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYLLPTGETVYFI ASVVVLYNVEEQLQRHYAGHNDDVKCLAVHPDRITIATGQVAGTSKDGKQ LPPHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSND HVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTL EGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGNILVWGKGTNR ISYAVQGAHEGGIFALCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIP EQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGHTDELWGLA INASKSQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVA VGTLTGRWFVFDTGTKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCI YIYGVSDNGRKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWV PSACKQVVSVETTRDIEWATYTCTLGFHVFGVWPEGSDGTDINAVCRAHE KKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLI STGGKDTSIMQWRVI
    • Molecular weight116 kDa including tags
    • Amino acids1 to 815

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • echinoderm microtubule associated protein like 1
    • Echinoderm microtubule-associated protein-like 1
    • ELP79
    • EMAL1_HUMAN
    • EMAP
    • EMAP-1
    • EMAPL
    • Eml1
    • FLJ45033
    • HuEMAP
    • HuEMAP-1
    see all
  • FunctionMay modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.
  • Tissue specificityUbiquitous; expressed in most tissues with the exception of thymus and peripheral blood lymphocytes.
  • Sequence similaritiesBelongs to the WD repeat EMAP family.
    Contains 10 WD repeats.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human EML1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116907 at approximately 115.76 kDa.

References for Recombinant Human EML1 protein (ab116907)

ab116907 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"