Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTK TWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYAT GLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLAL VSGIIYIHLRKRE
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 163

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • EMP 3
    • EMP-3
    • Emp3
    • EMP3_HUMAN
    • Epithelial membrane protein 3
    • Hematopoietic neural membrane protein
    • Hematopoietic neural membrane protein 1
    • HGNC:3335
    • HNMP 1
    • HNMP-1
    • Protein YMP
    • YMP
    • YMP protein
    see all
  • Function
    Probably involved in cell proliferation and cell-cell interactions.
  • Sequence similarities
    Belongs to the PMP-22/EMP/MP20 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Recombinant Human EMP3 protein images

  • 12.5% SDS-PAGE showing ab117020 at approximately 43.67 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human EMP3 protein (ab117020)

ab117020 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up