Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLI
    • Amino acids
      26 to 75
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EMP 3
    • EMP-3
    • Emp3
    • EMP3_HUMAN
    • Epithelial membrane protein 3
    • Hematopoietic neural membrane protein
    • Hematopoietic neural membrane protein 1
    • HGNC:3335
    • HNMP 1
    • HNMP-1
    • Protein YMP
    • YMP
    • YMP protein
    see all
  • Function
    Probably involved in cell proliferation and cell-cell interactions.
  • Sequence similarities
    Belongs to the PMP-22/EMP/MP20 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158359 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up