Recombinant Human Endonuclease V protein (ab166165)

Overview

  • Product name
    Recombinant Human Endonuclease V protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGG VDVSFVKGDSVRACASLVVLSFPELEVLLVDGNGVLHHRGFGVACHLGVL TDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRGDSFPLLGDSGTVLGM ALRSHDRSTRPLYISVGHRMSLEAAVRLTCCCCRFRIPEPVRQADICSRE HIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSGEGQPPQDHSPGPRTA PRPGSQEQAGKDWQ
    • Amino acids
      1 to 264
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A730011L01Rik
    • Endonuclease V
    • ENDOV
    • ENDOV_MOUSE
  • Function
    Selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. Shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil.
  • Tissue specificity
    Highest levels detected in liver with high levels also found in heart, kidney and testis. Expressed at low levels in brain.
  • Sequence similarities
    Belongs to the endonuclease V family.
  • Information by UniProt

Images

  • ab166165 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up