Recombinant Human Endothelin B Receptor protein (ab114259)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDR TAGSPPRTISPPPCQGPIEIKETFK
    • Molecular weight
      34 kDa including tags
    • Amino acids
      27 to 101

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABCDS
    • Ednra
    • EDNRB
    • EDNRB_HUMAN
    • Endothelin B receptor
    • Endothelin B receptor precursor
    • Endothelin receptor Non selective type
    • Endothelin receptor non-selective type
    • Endothelin receptor type B
    • ET B
    • ET-B
    • ET-BR
    • ETB
    • ETBR
    • ETRB
    • Hirschsprung disease 2
    • HSCR
    • HSCR2
    • OTTHUMP00000018534
    • OTTHUMP00000178736
    • WS4A
    see all
  • Function
    Non-specific receptor for endothelin 1, 2, and 3. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity
    Expressed in placental stem villi vessels, but not in cultured placental villi smooth muscle cells.
  • Involvement in disease
    Defects in EDNRB are a cause of Waardenburg syndrome type 4A (WS4A) [MIM:277580]; also known as Waardenburg-Shah syndrome. WS4A is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
    Defects in EDNRB are the cause of Hirschsprung disease type 2 (HSCR2) [MIM:600155]; also known as aganglionic megacolon (MGC). HSCR2 is a congenital disorder characterized by absence of enteric ganglia along a variable length of the intestine. It is the most common cause of congenital intestinal obstruction. Early symptoms range from complete acute neonatal obstruction, characterized by vomiting, abdominal distention and failure to pass stool, to chronic constipation in the older child.
    Defects in EDNRB are the cause of ABCD syndrome (ABCDS) [MIM:600501]. ABCD syndrome is an autosomal recessive syndrome characterized by albinism, black lock at temporal occipital region, bilateral deafness, aganglionosis of the large intestine and total absence of neurocytes and nerve fibers in the small intestine.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRB sub-subfamily.
  • Post-translational
    modifications
    Palmitoylation of Cys-402 was confirmed by the palmitoylation of Cys-402 in a deletion mutant lacking both Cys-403 and Cys-405.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114259 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your reply.


Both recombinant fragment peptide are validated for ELISA, but the protocol used will depend largely on the antibodies being used in the assay. The data I sent previously included relevant protocol information....

Read More

Thank you for your reply.


Both proteins have been used in different ELISA assays:


Regarding ab114239, this was tested in a sELISA. On the other hand, ab114259 was tested in a simple ELISA assay in which the protein was c...

Read More

Thank you for contacting Abcam regarding the proteins ab114239 and ab114259.


I have reviewed the product specifications of these proteins as well as the kit protocols the customer is using. It is important to note that both of these pro...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up