Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELR DNDKTRYM GKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMD GTENKSKFGANAILGVSL AVCKAGAVEKGVPLYRHIADLAGNSEVILP VPAFNVINGGSHAGNKLAMQEFMILPVG AANFREAMRIGAEVYHNLKN VIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIG KAGYTDKVVI GMDVAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVV SIEDPFDQDDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAVNEKSCNCL LLKVNQIG SVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGL CTGQIKTGAPCRSERLAK YNQLLRIEEELGSKAKFAGRNFRNPLAK

Specifications

Our Abpromise guarantee covers the use of ab88286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88286 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • 2 phospho D glycerate hydro lyase
    • 2-phospho-D-glycerate hydro-lyase
    • Alpha enolase
    • Alpha enolase like 1
    • Alpha-enolase
    • C myc promoter binding protein
    • C-myc promoter-binding protein
    • EC 4.2.1.11
    • eno1
    • ENO1L1
    • ENOA_HUMAN
    • Enolase 1
    • Enolase 1 (alpha)
    • Enolase 1 (alpha) like 1
    • Enolase alpha
    • MBP 1
    • MBP-1
    • MBP1
    • MBPB1
    • MPB 1
    • MPB-1
    • MPB1
    • MYC promoter binding protein 1
    • NNE
    • Non neural enolase
    • Non-neural enolase
    • Phosphopyruvate hydratase
    • Plasminogen binding protein
    • Plasminogen-binding protein
    • PPH
    • Tau crystallin
    see all
  • FunctionMultifunctional enzyme that, as well as its role in glycolysis, plays a part in various processes such as growth control, hypoxia tolerance and allergic responses. May also function in the intravascular and pericellular fibrinolytic system due to its ability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons. Stimulates immunoglobulin production.
    MBP1 binds to the myc promoter and acts as a transcriptional repressor. May be a tumor suppressor.
  • Tissue specificityThe alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • PathwayCarbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Sequence similaritiesBelongs to the enolase family.
  • Developmental stageDuring ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localizationNucleus and Cytoplasm. Cell membrane. Cytoplasm > myofibril > sarcomere > M line. Can translocate to the plasma membrane in either the homodimeric (alpha/alpha) or heterodimeric (alpha/gamma) form. ENO1 is localized to the M line.
  • Information by UniProt

References for Recombinant Human ENO1 protein (ab88286)

ab88286 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"