Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
    • Molecular weight
      31 kDa including tags
    • Amino acids
      228 to 277

Specifications

Our Abpromise guarantee covers the use of ab114838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 phospho D glycerate hydrol yase
    • 2 phospho D glycerate hydrolyase
    • 2-phospho-D-glycerate hydro-lyase
    • Beta enolase
    • Beta-enolase
    • ENO3
    • ENOB_HUMAN
    • Enolase 3
    • Enolase 3 (beta muscle)
    • Enolase3
    • GSD13
    • MSE
    • Muscle specific enolase
    • Muscle-specific enolase
    • Skeletal muscle enolase
    see all
  • Function
    Appears to have a function in striated muscle development and regeneration.
  • Tissue specificity
    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Involvement in disease
    Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13) [MIM:612932]. A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen-beta particles are detected on ultrastructural analysis.
  • Sequence similarities
    Belongs to the enolase family.
  • Developmental stage
    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localization
    Cytoplasm. Localized to the Z line. Some colocalization with CKM at M-band.
  • Information by UniProt

Recombinant Human ENO3 protein images

  • ab114838 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human ENO3 protein (ab114838)

ab114838 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up