Recombinant Human eNOS protein (ab112329)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP29474
    • SpeciesHuman
    • SequenceQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQ GRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT
    • Molecular weight37 kDa including tags
    • Amino acids61 to 160
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • cNOS
    • Constitutive NOS
    • EC NOS
    • EC-NOS
    • ecNOS
    • Endothelial nitric oxidase synthase
    • Endothelial nitric oxide synthase
    • Endothelial nitric oxide synthase 3
    • Endothelial NOS
    • eNOS
    • Nitric oxide synthase 3
    • Nitric oxide synthase 3 (endothelial cell)
    • Nitric oxide synthase 3 endothelial cell
    • Nitric oxide synthase endothelial
    • Nitric oxide synthase, endothelial
    • NOS 3
    • NOS III
    • NOS type III
    • NOS3
    • NOS3_HUMAN
    • NOSIII
    see all
  • FunctionProduces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
    Isoform eNOS13C: Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.
  • Tissue specificityPlatelets, placenta, liver and kidney.
  • Involvement in diseaseVariation in NOS3 seem to be associated with susceptibility to coronary spasm.
  • Sequence similaritiesBelongs to the NOS family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Post-translational
    modifications
    Phosphorylation by AMPK at Ser-1177 in the presence of Ca(2+)-calmodulin (CaM) activates activity. In absence of Ca(2+)-calmodulin, AMPK also phosphorylates Thr-495, resulting in inhibition of activity (By similarity). Phosphorylation of Ser-114 by CDK5 reduces activity.
  • Cellular localizationCell membrane. Membrane, caveola. Cytoplasm, cytoskeleton. Golgi apparatus. Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle and which is favored by interaction with NOSIP and results in a reduced enzymatic activity.
  • Information by UniProt

Recombinant Human eNOS protein images

  • ab112329 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human eNOS protein (ab112329)

ab112329 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

We have:

DDAH1 protein (http://www.abcam.com/ab99863), Recombinant full length Human DDAH1 (amino acids 1-285) with an N terminal His tag.
DDAH2 protein (Tagged-His Tag) (http://www.abcam.com/ab92017),...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"