Overview

  • Product name
    Recombinant Human ENPP3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQL GDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
    • Amino acids
      602 to 699
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alkaline phosphodiesterase I
    • ARHR2
    • B10
    • CD203c
    • CD203c antigen
    • dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)
    • dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)
    • E NPP 3
    • E-NPP 3
    • Ectonucleotide pyrophosphatase/phosphodiesterase 3
    • Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
    • ENPP3
    • ENPP3_HUMAN
    • gp130RB13 6
    • gp130RB136
    • M6S1
    • NPP1
    • NPP3
    • NPPase
    • NPPS
    • Nucleotide pyrophosphatase
    • PC-1
    • PCA1
    • PD Ibeta
    • PD-Ibeta
    • PDNP1
    • PDNP3
    • Phosphodiesterase I beta
    • Phosphodiesterase I/nucleotide pyrophosphatase 3
    • phosphodiesterase i/nucleotide pyrophosphatase beta
    see all
  • Function
    Cleaves a variety of phosphodiester and phosphosulfate bonds including deoxynucleotides, nucleotide sugars, and NAD.
  • Tissue specificity
    Expressed in bile ducts, prostate, uterus and colon. Exclusively expressed on basophils, mast cells and their progenitors.
  • Sequence similarities
    Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.
    Contains 2 SMB (somatomedin-B) domains.
  • Post-translational
    modifications
    N-glycosylation is necessary for correct trafficking to the apical surface, but is not the apical targeting signal.
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus two alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
  • Cellular localization
    Membrane. Secreted. Located to the apical surface in intestinal and kidney epithelial cells. Located to the cell surface of basophils, and to the apical plasma membrane of bile duct cells. Secreted in serum, and in lumen of epithelial cells.
  • Information by UniProt

Images

  • ab159085 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up