Recombinant Human ENTPD2 protein (ab158059)

Overview

  • Product name
    Recombinant Human ENTPD2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVY THSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVL
    • Amino acids
      187 to 275
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NTPDase 2
    • NTPDase2
    • CD39 antigen like 1
    • CD39 antigen-like 1
    • CD39 like1
    • CD39L1
    • CD39like1
    • ecto ATP diphosphohydrolase 2
    • ecto ATPase 2
    • ecto ATPDase 2
    • Ecto-ATP diphosphohydrolase 2
    • Ecto-ATPase 2
    • Ecto-ATPDase 2
    • ectoATPase 2
    • ectoATPDase 2
    • Ectonucleoside triphosphate diphosphohydrolase 2
    • ENTP2_HUMAN
    • Entpd2
    • NTPDase 2
    see all
  • Function
    In the nervous system, could hydrolyze ATP and other nucleotides to regulate purinergic neurotransmission. Hydrolyzes ADP only to a marginal extent. The order of activity with different substrates is ATP > GTP > CTP = ITP > UTP >> ADP = UDP.
  • Tissue specificity
    Brain, placenta, skeletal muscle, kidney, pancreas, heart, ovary, testis, colon, small intestine, prostate and pancreas. No expression in adult thymus, spleen, lung, liver and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the GDA1/CD39 NTPase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158059 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up