Recombinant Human ENTPD3 protein (ab158062)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEV LESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMW VHPHGVETTG
    • Amino acids
      107 to 216
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATPDase
    • CD39 antigen like 3
    • CD39 antigen-like 3
    • CD39 like 3
    • CD39L3
    • Ecto apyrase
    • Ecto ATP diphosphohydrolase
    • Ecto-apyrase 3
    • Ecto-ATP diphosphohydrolase 3
    • Ecto-ATPase 3
    • Ecto-ATPDase 3
    • Ectonucleoside triphosphate diphosphohydrolase 3
    • ENTP3_HUMAN
    • ENTPD 3
    • ENTPD3
    • FLJ93839
    • HB 6
    • HB6
    • NTPDase 3
    • NTPDase3
    • OTTHUMP00000162079
    • OTTHUMP00000209227
    • OTTHUMP00000209228
    see all
  • Function
    Has a threefold preference for the hydrolysis of ATP over ADP.
  • Tissue specificity
    Expressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the GDA1/CD39 NTPase family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158062 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up