Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQA STERVLRAGRQLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILAL GLGVHSRSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPV GTHEMEEELAEAVALLSQRGPDALLTVALRKPPGQRTDEELDLIFEELLH IKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVN VVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDF NRIIKDVEAKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGT PEKILELLLEAMGPDSSAHDPTETFLSDFLLTHRVFMPSAQLCAALLHHF HVEPAGGSEQERSTYVCNKRQQILRLVSQWVALYGSMLHTDPVATSFLQK LSDLVGRDTRLSNLLREQWPERRRCHRLENGCGNASPQMKARNLPVWLPN QDEPLPGSSCAIQVGDKVPYDICRPDHSVLTLQLPVTASVREVMAALAQE DGWTKGQVLVKVNSAGDAIGLQPDARGVATSLGLNERLFVVNPQEVHELI PHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVLG PQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLA AHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLD PSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGNHTLVENLINFEKM RMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQSLST RSPASTWAYVQQLKVIDNQRELSRLSRELEP
    • Amino acids
      1 to 881
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160975 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bcm910
    • CAMP GEFI
    • cAMP regulated guanine nucleotide exchange factor I
    • CAMPGEFI
    • CGEF 1
    • CGEF1
    • EPA1
    • EPAC
    • Epac 1
    • EPAC1
    • Exchange factor directly activated by cAMP 1
    • Exchange protein directly activated by cAMP 1
    • MGC21410
    • RAP guanine nucleotide exchange factor
    • Rap guanine nucleotide exchange factor (GEF) 3
    • RAP guanine nucleotide exchange factor 3
    • Rap1 guanine nucleotide exchange factor directly activated by cAMP
    • RAPGEF3
    see all
  • Relevance
    The activation of RaP1 by cAMP is independent of PKA and is mediated by recently discovered family of guanine nucleotide exchange factors (GEFs) called cAMP-GEFs or Epacs. The Epac signaling therefore represents a novel mechanism for cAMP signaling with in the cAMP cascade. There are 2 members of the Epac family, Epac1 and Epac 2. Both proteins are multidomain proteins containing an autoinhibitory cAMP-binding domain that inhibits the catalytic region and a DEP domain (dishevelled, Egl-10 and pleckstrin homology domain) targeting the membrane anchors. EPAC2 has an additional cAMP-binding site in its N-terminus that binds cAMP with low affinity. EPAC1 mRNA is broadly expressed, with particularly high levels occurring in the thyroid, ovary, kidney and certain brain regions, whereas expression of EPAC2 mRNA appears to be restricted to the brain and adrenal glands. Epac 1 and Epac 2 also interact with light chain 2 (LC2) or MAP1A that serves as a scaffolding structure to stabilize the signal transduction complex. The Epac 1-selective antibodies were generated against unique antigenic sequences form near N-terminus and between RasGEFN and Ras GEF domains. The antibodies to Epac 1are affinity purified over immobilized antigen based chromatography.
  • Cellular localization
    Endomembrane system

Images

  • ab160975 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160975 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160975.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up