Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11171
    • SpeciesHuman
    • SequenceMTTEKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCE QKLKASNGDTPTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSEEEGK EVESDKEKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSL SSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKAS QKPIRKHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDY FGLAIWDNATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDI TRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYV SDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDL HKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIK IRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKF LALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVD SADRSPRPTSAPAITQGQVAEGGVLDASAKKTVVPKAQKETVKAEVKKED EPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKKRERLDGENIYIRHS NLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPF RTLNINGQIPTGEGVSTLST
    • Molecular weight105 kDa including tags
    • Amino acids1 to 720

Specifications

Our Abpromise guarantee covers the use of ab114654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4.1R
    • 41_HUMAN
    • Band 4.1
    • E41P
    • EL 1
    • EL1
    • EL1 gene
    • Elliptocytosis 1
    • Elliptocytosis 1 RH linked
    • EPB 4.1
    • EPB 41
    • EPB4.1
    • Epb41
    • Erythrocyte membrane protein band 4.1
    • Erythrocyte membrane protein band 4.1 (elliptocytosis 1 RH linked)
    • Erythrocyte surface protein band 4.1
    • HE
    • P4.1
    • Protein 4.1
    • Protein 4.1, red blood cell type
    see all
  • FunctionProtein 4.1 is a major structural element of the erythrocyte membrane skeleton. It plays a key role in regulating membrane physical properties of mechanical stability and deformability by stabilizing spectrin-actin interaction. Recruits DLG1 to membranes.
  • Involvement in diseaseDefects in EPB41 are the cause of elliptocytosis type 1 (EL1) [MIM:611804]. EL1 is a Rhesus-linked form of hereditary elliptocytosis, a genetically heterogeneous, autosomal dominant, hematologic disorder. It is characterized by variable hemolytic anemia and elliptical or oval red cell shape.
    Defects in EPB41 are a cause of hereditary pyropoikilocytosis (HPP) [MIM:266140]. HPP is an autosomal recessive hematologic disorder characterized by hemolytic anemia, microspherocytosis, poikilocytosis, and an unusual thermal sensitivity of red cells.
  • Sequence similaritiesContains 1 FERM domain.
  • Post-translational
    modifications
    Phosphorylated at multiple sites by different protein kinases and each phosphorylation event selectively modulates the protein's functions.
    Phosphorylation on Tyr-660 reduces the ability of 4.1 to promote the assembly of the spectrin/actin/4.1 ternary complex.
    O-glycosylated; contains N-acetylglucosamine side chains in the C-terminal domain.
  • Cellular localizationCytoplasm > cytoskeleton. Cytoplasm > cell cortex. Nucleus.
  • Information by UniProt

Recombinant Human EPB41 protein images

  • 12.5% SDS-PAGE showing ab114654 at approximately 105.27kDa stained with Coomassie Blue.

References for Recombinant Human EPB41 protein (ab114654)

ab114654 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"