Recombinant Human EPB41L1 protein (ab117025)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9H4G0-2
    • SpeciesHuman
    • SequenceMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECE VEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQI RSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTH ALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYR GMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRD RLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKR LWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDR PAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESG GQRSEAEEGEVRTPTKIKELKFLDKPEDVLLKHQASINELKRTLKEPNSK LIHRDRDWERERRLPSSPASPSPKGTPEKANERAGLREGSEEKVKPPRPR APESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTV IGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGG IEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVSAM DNTQENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAET LSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQ HPDMLVTKAVVYRETDPSPEERDKKPQES
    • Molecular weight112 kDa including tags
    • Amino acids1 to 779

Associated products

Specifications

Our Abpromise guarantee covers the use of ab117025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 4.1N
    • Band 4.1 like protein 1
    • Band 4.1-like protein 1
    • DKFZp686H17242
    • E41L1_HUMAN
    • EPB41L 1
    • Epb41l1
    • Erythrocyte membrane protein band 4.1 like 1
    • KIAA0338
    • MGC11072
    • MRD11
    • Neuron type nonerythroid protein 4.1
    • Neuronal protein 4.1
    • Nonerythroid protein 4.1
    • Nonerythroid protein 4.1, neuron type
    • OTTHUMP00000030825
    • OTTHUMP00000030826
    • OTTHUMP00000030827
    • OTTHUMP00000030829
    see all
  • FunctionMay function to confer stability and plasticity to neuronal membrane via multiple interactions, including the spectrin-actin-based cytoskeleton, integral membrane channels and membrane-associated guanylate kinases.
  • Tissue specificityHighest expression in brain, lower in heart, kidney, pancreas, placenta, lung and skeletal muscle.
  • Sequence similaritiesContains 1 FERM domain.
  • Cellular localizationCytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human EPB41L1 protein images

  • 12.5% SDS-PAGE showing ab117025 at approximately 111.76 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human EPB41L1 protein (ab117025)

ab117025 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"