Recombinant Human EPB41L1 protein (ab117025)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECE VEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQI RSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTH ALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYR GMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRD RLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKR LWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDR PAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESG GQRSEAEEGEVRTPTKIKELKFLDKPEDVLLKHQASINELKRTLKEPNSK LIHRDRDWERERRLPSSPASPSPKGTPEKANERAGLREGSEEKVKPPRPR APESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTV IGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGG IEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVSAM DNTQENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAET LSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQ HPDMLVTKAVVYRETDPSPEERDKKPQES
    • Molecular weight
      112 kDa including tags
    • Amino acids
      1 to 779

Specifications

Our Abpromise guarantee covers the use of ab117025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 4.1N
    • Band 4.1 like protein 1
    • Band 4.1-like protein 1
    • DKFZp686H17242
    • E41L1_HUMAN
    • EPB41L 1
    • Epb41l1
    • Erythrocyte membrane protein band 4.1 like 1
    • KIAA0338
    • MGC11072
    • MRD11
    • Neuron type nonerythroid protein 4.1
    • Neuronal protein 4.1
    • Nonerythroid protein 4.1
    • Nonerythroid protein 4.1, neuron type
    • OTTHUMP00000030825
    • OTTHUMP00000030826
    • OTTHUMP00000030827
    • OTTHUMP00000030829
    see all
  • Function
    May function to confer stability and plasticity to neuronal membrane via multiple interactions, including the spectrin-actin-based cytoskeleton, integral membrane channels and membrane-associated guanylate kinases.
  • Tissue specificity
    Highest expression in brain, lower in heart, kidney, pancreas, placenta, lung and skeletal muscle.
  • Sequence similarities
    Contains 1 FERM domain.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117025 at approximately 111.76 kDa.
    Stained with Coomassie Blue.

References

ab117025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up