Recombinant Human EPB41L5 protein (ab153458)

Overview

  • Product name
    Recombinant Human EPB41L5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLL DGTDVSVDLPKKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDG TKSIKKQVKIGSPYCLHLRVKFYSSEPNNLREELTRYLFVLQLKQDILSG KLDCPFDTAVQLAAYNLQAELGDYDLAEHSPELVSEFRFVPIQTEEMELA IFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKARDGNDYSLGLT PTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGK TEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVST QSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRKCIPLN IDLLNSPDLLEATIGDVIGASDTMETSQALNDVNVATRLPGLGEPEVEYE TLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLTEKCLNNVIES PGLNVMRVPPDFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAV LNENNVPLPKESLETLMLITPADSGSVLKEATDELDALLASLTENLIDHT VAPQVSSTSMITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLIS PPAPFLVDAVTSSGPILAEEAVLKQKCLLTTEL
    • Amino acids
      1 to 733
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153458 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Band 4.1-like protein 5
    • BE37
    • E41L5_HUMAN
    • Epb41l5
    • erythrocyte membrane protein band 4.1 like 5
    • KIAA1548
    see all
  • Function
    May contribute to the correct positioning of tight junctions during the establishment of polarity in epithelial cells.
  • Sequence similarities
    Contains 1 FERM domain.
  • Domain
    The FERM domain binds to CRB1.
  • Cellular localization
    Cytoplasm. Cell junction > adherens junction. Associated with the plasma membrane. Colocalizes with CTNNB1, an adherens junction marker.
  • Information by UniProt

Images

  • ab153458 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153458 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153458.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up