Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP16452-2
    • SpeciesHuman
    • SequenceKMPEKAEQYQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSV WPENTMCAKFQFTPTHVGLQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
    • Molecular weight37 kDa including tags
    • Amino acids623 to 721

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPB42
    • EPB42_HUMAN
    • Erythrocyte membrane protein band 4.2
    • Erythrocyte protein 4.2
    • Erythrocyte surface protein band 4.2
    • MGC116735
    • MGC116737
    • P4.2
    • PA
    • SPH5
    see all
  • FunctionProbably plays an important role in the regulation of erythrocyte shape and mechanical properties.
  • Involvement in diseaseDefects in EPB42 are the cause of spherocytosis type 5 (SPH5) [MIM:612690]; also known as hereditary spherocytosis type 5 (HS5). Spherocytosis is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal. Absence of band 4.2 associated with spur or target erythrocytes has also been reported.
  • Sequence similaritiesBelongs to the transglutaminase superfamily. Transglutaminase family.
  • Post-translational
    modifications
    Both cAMP-dependent kinase (CAPK) and another kinase present in the red-blood cells seem to be able to phosphorylate EPB42.
  • Cellular localizationCell membrane. Cytoplasm > cytoskeleton. Cytoplasmic surface of erythrocyte membranes.
  • Information by UniProt

Recombinant Human EPB42 protein images

  • 12.5% SDS-PAGE showing ab114956 at approximately 36.52kDa.
    Stained with Coomassie Blue.

References for Recombinant Human EPB42 protein (ab114956)

ab114956 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"